[K] (SPT15) COG2101 TATA-box binding protein (TBP), component of TFIID and TFIIIB 1 genomes BUD4452 2 proteins a Hsa Halobacterium sp. NRC-1 b Hma Haloarcula marismortui f Hvo Haloferax volcanii g Hbo Halogeometricum borinquense h Hmu Halomicrobium mukohataei i Hut Halorhabdus utahensis j Hla Halorubrum lacusprofundi q Nph Natronomonas pharaonis x Hwa Haloquadratum walsbyi VNG5039 VNG6037 - - - - - - - -

Pairwise sequence scores
Consensus score	542	VNG5039	VNG6037
542	VNG5039	542	542
542	VNG6037	542	542

71 symbols
consensus       MDLEGADYDPEQFPGLVYRLDEPSVVALLFGSGKLVITGGKHPVDAEHAVDTIDSRLEDL
#oth            ............................................................
VNG5039         ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
VNG6037         ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::

consensus       GLLDGYGDRAK
#oth            ...........
VNG5039         :::::::::::
VNG6037         :::::::::::